Fragments Peptides Projects

Project Others Method ID/Specs Description Peptide Type Fragment Sequence
Structure from eb_source EM 7NRQ Paired helical filament from primary age-related tauopathy brain Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7NRS Conformation 1 of straight filament from primary age-related tauopathy brain Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7NRT Conformation 2 of straight filament from primary age-related tauopathy brain Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7NRV Paired helical filament from Alzheimer's disease with PET ligand APN-1607 Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7NRX Straight filament from Alzheimer's disease with PET ligand APN-1607 Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 6NWP Chronic traumatic encephalopathy Type I Tau filament Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 6NWQ Chronic traumatic encephalopathy Type II Tau filament Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7QJV In vitro assembled tau filaments into Quadruple Helical Filaments type 1 (2c) Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7QJW In vitro assembled tau filaments with structures like chronic traumatic encephalopathy type II (8a) Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Structure from eb_source EM 7QJX In vitro assembled 297-394 tau filaments, 700 rpm (34b) Wild Type Tau8(304-380) GSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
« First Previous Page 4 of 17 Next Last »
Go to selected Project Add Project for selected Peptide